Basic Information | |
---|---|
Taxon OID | 3300010198 Open in IMG/M |
Scaffold ID | Ga0127509_1269418 Open in IMG/M |
Source Dataset Name | Peat moss associated microbial communities from Sphagnum species from Minnesota, USA - S1T2_Fd - Sphagnum magellanicum MT (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 879 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Gnathifera → Rotifera → Eurotatoria → Monogononta → Pseudotrocha → Ploima → Brachionidae → Brachionus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Minnesota | |||||||
Coordinates | Lat. (o) | 47.5028 | Long. (o) | -93.4828 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022887 | Metagenome / Metatranscriptome | 212 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0127509_12694181 | F022887 | N/A | MPRDQLGNQILERKLKRFYALTLDTNNDGLVNWLDFEAAVENIVPKEDSERNSRLKILRKRLEQNFQKYFWDLCEVGDANKDGNIDLEEWLDVMNDIIIHLKENGKFPEWYEGLHKALFRSNEFYDDRDVLKDEFVIMMSAWSINEDAAKKAYDYITENGKKKLDYNLFSEFMKQFFTNEEFDHAVNLGLDKP* |
⦗Top⦘ |