Basic Information | |
---|---|
Taxon OID | 3300009966 Open in IMG/M |
Scaffold ID | Ga0133736_1449819 Open in IMG/M |
Source Dataset Name | Termite gut microbial communities. Combined Assembly of Gp0151149, Gp0151152, Gp0151222, Gp0151223 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Luxembourg, Luxembourg Institute of Science and Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 896 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | France | |||||||
Coordinates | Lat. (o) | 48.913957 | Long. (o) | 2.485499 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000190 | Metagenome | 1676 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0133736_14498191 | F000190 | N/A | DAVDAVVCAPGDGWWCRPRCVEPFPDGMSCVMLILVGYILESFV* |
⦗Top⦘ |