Basic Information | |
---|---|
Taxon OID | 3300009845 Open in IMG/M |
Scaffold ID | Ga0132158_109032 Open in IMG/M |
Source Dataset Name | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 3, 3m depth; RNA IDBA-UD |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 641 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Falmouth, Massachusetts | |||||||
Coordinates | Lat. (o) | 41.548517 | Long. (o) | -70.622961 | Alt. (m) | Depth (m) | 3 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000920 | Metatranscriptome | 833 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0132158_1090321 | F000920 | N/A | ENDAIIVSATQRVAELSKEIADLQTSMKDATTMRNEESAKNAETVADAVEALKAVEAATAVLKEFYEKASTATALLQNSNAKPTMGSEEWNSLANPNFEGKVDKGHKEGMQTFGEKYTGQQDQAGGVMALLEVILSDFANLEAETKAAEAKSQESYESFMTESKKTKATKVKKIEMDTADKAAAEAKLQEDTKDLKGTQDELLAADRYYEKLV |
⦗Top⦘ |