NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126313_10162009

Scaffold Ga0126313_10162009


Overview

Basic Information
Taxon OID3300009840 Open in IMG/M
Scaffold IDGa0126313_10162009 Open in IMG/M
Source Dataset NameSerpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1697
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa

Source Dataset Sampling Location
Location NameUC McLaughlin Reserve (Lake County, CA)
CoordinatesLat. (o)38.8722Long. (o)-122.4269Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030396Metagenome / Metatranscriptome185Y

Sequences

Protein IDFamilyRBSSequence
Ga0126313_101620093F030396GGAGGMTEDERELIFELATALSGALVVNYEQVDFRDSPIIDRIAQVAAMMNAHDWEVPPVVRDVLRKAAEAGRPIGTG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.