| Basic Information | |
|---|---|
| Taxon OID | 3300009787 Open in IMG/M |
| Scaffold ID | Ga0116226_10042312 Open in IMG/M |
| Source Dataset Name | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4569 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Juglandaceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Communities From Peat Moss Sphagnum Species From Minnesota, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Minnesota | |||||||
| Coordinates | Lat. (o) | 47.5028 | Long. (o) | -93.4828 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037022 | Metagenome / Metatranscriptome | 168 | Y |
| F085030 | Metagenome / Metatranscriptome | 111 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116226_100423122 | F037022 | N/A | VLIGHSFGGLVLKSLVVKLKRVATIGNATDSWSKATVQCAKVFLRNVRGVAFYAVPHAQASNIAKYVDKLLRCNNRHHGGIVDNIQPWRKDMEQLSMDFDDIVHENEINIYAFCEGIPMEHVVRICWIR* |
| Ga0116226_100423123 | F085030 | GGA | LYNVFNVEFVSQSDWPVHELWSPPESNQRTELDVVLFHGLQLTANGAVDAWSSTWTQRGHGDVCWPREWLPFDLGESVRIFSVSYNADLVASPHDHVSEIAHNLFQTLVDPRYNYLLLFKMACLGKCMVSFTNI* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |