Basic Information | |
---|---|
Taxon OID | 3300009683 Open in IMG/M |
Scaffold ID | Ga0116224_10307369 Open in IMG/M |
Source Dataset Name | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 754 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Germany: Weissenstadt | |||||||
Coordinates | Lat. (o) | 50.1318 | Long. (o) | 11.881 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004969 | Metagenome / Metatranscriptome | 417 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116224_103073691 | F004969 | N/A | MCFSISKEKNMSRGLNPLGSLLLAAALASSLAGMACGGHHYYRVYDPYYTDYHVWNDDEVVYYNRWAAENHRDPHRDFRKLNKDE |
⦗Top⦘ |