NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116182_1037639

Scaffold Ga0116182_1037639


Overview

Basic Information
Taxon OID3300009666 Open in IMG/M
Scaffold IDGa0116182_1037639 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2886
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameUSA, Massachusetts, Boston
CoordinatesLat. (o)42.35Long. (o)-70.96Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021528Metagenome / Metatranscriptome218N
F051104Metagenome / Metatranscriptome144Y
F078674Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0116182_10376392F078674AGGAGGMEAIKKAVENRNAPFEVEGKAGGRIISLRVTEKMEQILEEQAQEWNMSISDTLRGILNFYFLPPVLYEAWEKKVQELIDLDTEQKGENRADMSAPTHAQRIEPVFCDSEEAEEYANFIHELWDKNLRYWEILREEAVTANRIAVKQLTETAEALKRCKYALPERAEVEP*
Ga0116182_10376396F051104AGGAGLFELRIAEVIEGEAVLSQKLIEEGFLHAFKAGELIQEVKSMLHSEEALEQWLEQNCSKVERQVAINCLKLFNGETVKVEATTKEGKNQKRERG*
Ga0116182_10376397F021528N/AQTPSHGSHYGSKAYLNAENWNLTLKPLPGGRATGAFLQLSVPKNYYGSNFYSVGEQGTQAVLSKVEGELKEKGVHTSLIEADMSRVDTFKNIEPEEPFSSYYTLFSLLKARRAIQRGYGTTFLLSNSQQEFCVYDKLEEMRERNIETGGLPNTMRFEHRLLNKQKVQNVYGFGKVEDLFRGGYAVVKEKQVESWKSSLFNFTAEELVVLGSKQLEQEMRRFKEKSPSGWFSKFLKAYGAYYLASYAGKEAVIEALKNAEAERTMIWRAVQKFEEAERELLVLKQEEGSKKTLGSLYEELRRKVCLN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.