NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116102_1013621

Scaffold Ga0116102_1013621


Overview

Basic Information
Taxon OID3300009632 Open in IMG/M
Scaffold IDGa0116102_1013621 Open in IMG/M
Source Dataset NamePeatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2920
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_60_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m).4 to .5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016480Metagenome / Metatranscriptome247Y
F039579Metagenome163Y

Sequences

Protein IDFamilyRBSSequence
Ga0116102_10136211F039579AGGAGMTEEIKVQPTAGEQAAAVPPIPQGHTGSALRGAERNDGEPTVSGAALLELLGSKKIPPLDGVQMLALLHYLYNAADRPLRFQIAEVVYRYDHDHPNAQDLFLACTLPSAVKAARRKAEKLFVHPSDWQVELMYDGAVTAAIEMFQLHPPLRSIPNAFRRYVVRGLSRGMLRSYFAREENSRIRPVGDVRAVRTRKRVIPNTVEREIIARELLDQVTNYANLRLPVRATLQCIAALGPDFALKEHAYTASGDPDKWKRDRGRRPVLDSAAIAEAMGIPKRDVHRYLCQARVILRQAFNADGRLFQIH*
Ga0116102_10136212F016480AGGAGMNREFQQYRFARIEAQNITRARLEAQFKNGIGGLEEIEKAIEQLIMTEPTCTPWRTSEVERAASRDGTRMAAFEFYWAHRRRRQLVDAGSGYPALTTVPNAKVC*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.