NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114912_1007309

Scaffold Ga0114912_1007309


Overview

Basic Information
Taxon OID3300009620 Open in IMG/M
Scaffold IDGa0114912_1007309 Open in IMG/M
Source Dataset NameMarine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3631
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)39.47Long. (o)11.53Alt. (m)Depth (m)3514
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008151Metagenome / Metatranscriptome338Y
F035959Metagenome / Metatranscriptome171Y
F035969Metagenome / Metatranscriptome171Y

Sequences

Protein IDFamilyRBSSequence
Ga0114912_10073091F035969GGAGVATRHTYATADDLRDYLAGTSYSSGWTSDAGSIRRILEAASRRIDDYCGGGTFGPLTETRYYDIGTGSLRNSPQYQ
Ga0114912_10073092F035959GGAGGMAKAKSLVNVTFGATGEMYEMGEVYDVPAALLKKYPDYFKKQSAKPRNKQAATGENK*
Ga0114912_10073095F008151N/AFETVDMLPPIETGNMEKILEAAYRRVSKRTFSAINDVGVAGTLDWSDKLPTVQRVLTQAPTRAAMIHRTTSKAIGRAVGIGLERGYSIEQLARGVPDDKFPGIRSILGETENRSRLIARTEIMRSQNQTTVGFYKEQGFGYVQADDVDGDPDDNYIDPGDPHGRTCAERHGQVYALDAAQNIDDHPNGTLNWTPMPRGYKPEETL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.