NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0123519_10089831

Scaffold Ga0123519_10089831


Overview

Basic Information
Taxon OID3300009503 Open in IMG/M
Scaffold IDGa0123519_10089831 Open in IMG/M
Source Dataset NameHot spring microbial communities from Yellowstone National Park - Yellowstone National Park OP-RAMG-02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2717
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park

Source Dataset Sampling Location
Location NameUSA: Yellowstone National Park
CoordinatesLat. (o)44.61Long. (o)-110.44Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006925Metagenome362Y

Sequences

Protein IDFamilyRBSSequence
Ga0123519_100898314F006925AGGTGGLAVEVSVLENFGREAELRKKWMRMWERLGVRILKMPKWMQEIVLEDINTAIRNRIAIMEIIQNAKR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.