NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115554_1067471

Scaffold Ga0115554_1067471


Overview

Basic Information
Taxon OID3300009472 Open in IMG/M
Scaffold IDGa0115554_1067471 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_110404
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1575
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002915Metagenome / Metatranscriptome521Y
F007087Metagenome / Metatranscriptome358N
F073140Metagenome / Metatranscriptome120N

Sequences

Protein IDFamilyRBSSequence
Ga0115554_10674711F073140N/ATKPYGCHFMSNNKWLSMYYYLVYKDEGMGCLWESSNPNVRIKYSVTLKTFENVPEQGRCILGD*
Ga0115554_10674712F002915AGGMKKLFLLILIIPILGQCKEVFTNDQGLKIEYVKPSVSCFYDKEAYEGYLNTCLMLPNYETCAQTKYENYICSDQNMIKQLEKKAKEAR*
Ga0115554_10674714F007087AGGMKKLLLIALTIPNLVLADDFKLVCEGEESNYRNDVLENTSKASLTLQVKNDSVVIDSMTYKSKTFDYGAIKGESKYIKEDTQVILETSQVSNECDTALLNVKLNRSNGMIESTAKRIGACDGSSFTTSTKFKGKCN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.