NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114994_10020769

Scaffold Ga0114994_10020769


Overview

Basic Information
Taxon OID3300009420 Open in IMG/M
Scaffold IDGa0114994_10020769 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4622
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (14.29%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)73.2247Long. (o)-150.2247Alt. (m)Depth (m)67
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007054Metagenome / Metatranscriptome359Y
F031863Metagenome / Metatranscriptome181Y
F071647Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0114994_1002076912F031863N/AMYWARDMIPMNGNLFVVKRRFRHDPFQKVINHFGSKTVCENYHCETVIKGGDGFFYLCDKVDDAQLV*
Ga0114994_100207694F007054N/AMSSKVLKFEKSIEGVKFTPAQKKIVNLILKGWEIEIVNRHHMNGGEMMWKNPNSSYLEHAGKVYKAFFNVFYQIKKQNGIEIPTNLFCK*
Ga0114994_100207695F071647N/AMTKRKSISKSEFLKSIQLAESNPFNAVRKPSTSKYVMRGGIPHKWVDGSLVSLTKLSK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.