Basic Information | |
---|---|
Taxon OID | 3300009304 Open in IMG/M |
Scaffold ID | Ga0116588_1178798 Open in IMG/M |
Source Dataset Name | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_2 SPAdes |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Liverpool |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 537 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | United Kingdom | |||||||
Coordinates | Lat. (o) | 54.9632021 | Long. (o) | -1.6348029 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F102576 | Metagenome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116588_11787982 | F102576 | AGGAGG | MNDLLMLEKYFPGGTLEGGIELANRLDWGLIVKMAGDSYVVSSGDAPIIRMDHKDAVQSFLYGLGLAYAVLPEHLFKSLEKALKEL* |
⦗Top⦘ |