NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114976_10053672

Scaffold Ga0114976_10053672


Overview

Basic Information
Taxon OID3300009184 Open in IMG/M
Scaffold IDGa0114976_10053672 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2369
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Simoncouche, Canada
CoordinatesLat. (o)48.2311Long. (o)-71.2508Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036553Metagenome169N
F039124Metagenome / Metatranscriptome164N

Sequences

Protein IDFamilyRBSSequence
Ga0114976_100536721F036553GGAMNDIDLYTKYSITNKYWTLSSKQTNVHYVNIGELIKKLYAIQKLGSNVGNIGLPPYGNSKLLPFDVEFECGKLDDKICNYYYRNIIPPCLFTNDDYKNLSTYNTDPWGRTFPFYMTGAVSKTYVDNIHRSYLSYSYVMFYQERLIRSGPLKVDLMSGKSPL
Ga0114976_100536722F039124GAGGMNTLLVSNSVGGMLKSHIDYPVINVQWVRMDNIVLWDYLTTLHLIDVDNSLVMFQGTLDVFYLRHRHNNDNVTKIDYNSDPWGRKFMINPSMYYCYFSYKMKYEVNIIVTTVNNGRVYCVDLIRETV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.