NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114968_10005623

Scaffold Ga0114968_10005623


Overview

Basic Information
Taxon OID3300009155 Open in IMG/M
Scaffold IDGa0114968_10005623 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9291
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (64.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Montjoie, Canada
CoordinatesLat. (o)45.4091Long. (o)-72.0994Alt. (m)Depth (m)3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029327Metagenome188Y
F033402Metagenome / Metatranscriptome177Y
F056283Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0114968_1000562311F056283N/AMPILLHYEYSKNLGANMFETMVDQLVKVTLTNEPVKTEFYNGTLFVRKIDENQARRVFHRLSKTLGLGSVYVTPIGNTGEYAFDFVAEKQQDEFSPFATVNS*
Ga0114968_1000562315F033402GGAGMAEIRLEGLNRRQQVLADIMWSIEEWDDVERFVATLPDRERIECEGIVEMMRLELVETYRAGMKIEDTAEATQLIDKIRKL*
Ga0114968_1000562316F029327AGGAGMGSFKDIEIDIMEWQYRGCSIEDTYIYFKDYVTLEDVVRIFAREEIL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.