NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0118730_1296770

Scaffold Ga0118730_1296770


Overview

Basic Information
Taxon OID3300009132 Open in IMG/M
Scaffold IDGa0118730_1296770 Open in IMG/M
Source Dataset NameCombined Assembly of Gp0139359, Gp0139510
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)839
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)103
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022754Metagenome / Metatranscriptome213Y
F036736Metagenome / Metatranscriptome169Y
F067823Metagenome / Metatranscriptome125Y

Sequences

Protein IDFamilyRBSSequence
Ga0118730_12967701F036736N/AIGALAVVGSFVTKRVFNNHDSLSNRISALEKTVVTKEDLIHIERNVEMILTHLINKGDTP
Ga0118730_12967703F022754N/AMLVIPPPYKMVNWTVNQVPTQIQLIHKSGLEVSYNASPVSCSFRPRNNREMVFKSSETACYAVYDLGSPTFIRHPDHWYPVEPPKPLKMNIGE*
Ga0118730_12967704F067823AGGAGMDIASMFEGQGWFEIAGQVVLIFTAITGALPDKFVQKIPVLSTVWPIFNWLAGN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.