| Basic Information | |
|---|---|
| Taxon OID | 3300009132 Open in IMG/M |
| Scaffold ID | Ga0118730_1035974 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0139359, Gp0139510 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Genomics Facility |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3905 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (42.86%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cariaco Basin, Venezuela | |||||||
| Coordinates | Lat. (o) | 10.5 | Long. (o) | -64.66 | Alt. (m) | Depth (m) | 103 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002915 | Metagenome / Metatranscriptome | 521 | Y |
| F004166 | Metagenome / Metatranscriptome | 450 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0118730_10359744 | F002915 | AGGA | MKNFLLLFLIISLPTKGKEIFINDQGISVEYIKPSVSCIYDKEAYEGYLNTCLMLPKYELCAQTKYENYICGDKNMIQKLEKKQTEHNKN* |
| Ga0118730_10359745 | F004166 | GGA | MKKLILLILIVLLISCSDNEKNDSWGSYATNKETKKLEFWFTSYKTRDECMEDMSWQLEGEGDSKRQRISNWHTTPYGCHFMSNNKWLSMYYYLIYRDENVGCLWESTNPNVRIKYSVTFKTFTNIPDQGRCILGN* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |