Basic Information | |
---|---|
Taxon OID | 3300009120 Open in IMG/M |
Scaffold ID | Ga0117941_1177206 Open in IMG/M |
Source Dataset Name | Lake sediment microbial communities from Tanners Lake, St. Paul, MN |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Minnesota - Twin Cities |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 586 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment → Freshwater Sediment Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Tanners Lake, St. Paul, MN | |||||||
Coordinates | Lat. (o) | 44.953471 | Long. (o) | -92.97875 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036766 | Metagenome / Metatranscriptome | 169 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117941_11772062 | F036766 | GGAGG | MNRSFASWIAANPGAAVFLTGLLGLLPLFGLGFAFFLPGAVPALVVLARAPRDGVMVAVGASLLLALAVWAIGRPPPVGLIYSLWVLGPPLALAVLLARTGSLGLCLQVAVLAGMVMVVLLHV |
⦗Top⦘ |