| Basic Information | |
|---|---|
| Taxon OID | 3300009089 Open in IMG/M |
| Scaffold ID | Ga0099828_10008286 Open in IMG/M |
| Source Dataset Name | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7601 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California, Eel River Critical Zone Observatory | |||||||
| Coordinates | Lat. (o) | 39.7291 | Long. (o) | -123.6419 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000949 | Metagenome / Metatranscriptome | 823 | Y |
| F003215 | Metagenome / Metatranscriptome | 500 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099828_100082865 | F003215 | GGAGG | MSFMSAALRMLKVIQLAMLGSILLYAVVGEVAGPRPKSVDPALTYVFTTLAVAIVGMIFVVRRTLVLRSAESLAARPDDALTLNHWRTGYIATYALCEALALIGLVLRFLGYNLQESLPYYAGGFVLLFFFGPKSPAAANVKT* |
| Ga0099828_100082869 | F000949 | N/A | MTSQESTRPVSRPRARTDIPFYLLAAVCGIGTGWADVAINDLLFTALLVLASCMLLGLLAPRWPWRWVVAVGVFIPLTELAAYLMSTVKPTRAQICGSFLASLPGIAGAYGGSFMRGVVRNLRQGK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |