| Basic Information | |
|---|---|
| Taxon OID | 3300009088 Open in IMG/M |
| Scaffold ID | Ga0099830_10000062 Open in IMG/M |
| Source Dataset Name | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 33367 |
| Total Scaffold Genes | 34 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 21 (61.76%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California, Eel River Critical Zone Observatory | |||||||
| Coordinates | Lat. (o) | 39.7291 | Long. (o) | -123.6419 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017367 | Metagenome / Metatranscriptome | 241 | Y |
| F031632 | Metagenome / Metatranscriptome | 182 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099830_1000006229 | F031632 | GGA | MKYLRTNACAICGEEQPGHETRFLVAENRWEDKLIIPPWNEQMASRAGIQVACSVNHVEELVVHWMTTGSVDYPFARTALGSGKWRRPAEPGCRVDLSGVRQIGELAVHRESMERVLAESPQSLQVILDALLEALRRETVGQADGISKREEEREEESCVVSSEPEY* |
| Ga0099830_1000006234 | F017367 | GGAG | LSFGRKLLLVFALTVFLSVGAVTWIVSAVTRRAFERANEAQTAALIA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |