NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066793_10218643

Scaffold Ga0066793_10218643


Overview

Basic Information
Taxon OID3300009029 Open in IMG/M
Scaffold IDGa0066793_10218643 Open in IMG/M
Source Dataset NamePermafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1107
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil → Permafrost Soil Microbial Communities From The Arctic, To Analyse Light Accelerated Degradation Of Dissolved Organic Matter (Dom)

Source Dataset Sampling Location
Location NameAlaska, USA
CoordinatesLat. (o)68.6139Long. (o)-149.3145Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000173Metagenome / Metatranscriptome1777Y
F001983Metagenome / Metatranscriptome608Y

Sequences

Protein IDFamilyRBSSequence
Ga0066793_102186431F001983N/AMEGGRMTRKSTLASLVVAVVLSLSLTACKDTKTLQENEQLKAKVADLQKQNGEMGNNLETVTAARDALTQENEALKAQVRVLKPKSPQKKPLSRKRRRR*
Ga0066793_102186432F000173GGAGGMKTFEVQFRYRDRNEETLESTVKVDASSLPGGVAKATREFVKGLDRKQRFDMNKNGLEITAKSGGTATEAPAKSSAEAAG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.