NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102816_1027530

Scaffold Ga0102816_1027530


Overview

Basic Information
Taxon OID3300008999 Open in IMG/M
Scaffold IDGa0102816_1027530 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1654
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2Long. (o)-123.94Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000447Metagenome / Metatranscriptome1128Y
F029434Metagenome / Metatranscriptome188Y
F050376Metagenome / Metatranscriptome145Y
F096663Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0102816_10275301F096663GAGGMKSQFEKDLEIKESFIDLLNDIYPSVKIGYSTFTPA
Ga0102816_10275302F029434GAGMKRYTFGVWLDIDAEDENQAVSLFDSVVKNTFVSDSYCFEWKEVADEIAV*
Ga0102816_10275303F000447AGGAGGMGYVEIFRLDDEGAGWVDLSEATPDELFNIELGLLNEGAFE*
Ga0102816_10275304F050376AGAAGGMNLDEYKAHVEAQRKASLLKAIATMSEANDKMSSLFNTKEAN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.