Basic Information | |
---|---|
Taxon OID | 3300008998 Open in IMG/M |
Scaffold ID | Ga0103502_10246752 Open in IMG/M |
Source Dataset Name | Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 656 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Chrysophyceae → Chromulinales → Chromulinaceae → Spumella → Spumella elongata | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088197 | Metatranscriptome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103502_102467521 | F088197 | AGG | MKVGTVFVAVWGACISQTEGSLLLRGRHSQEPDTSCGKGFENLVPGSKKYFKTAQEKLWVHPGRVGQEGTFEEELQCWYASMLTTKCGGLPSQYDKRNKELVGKCTKLDADWLDVWKLYSKDEVQYYKKDFPTDPLDEDEQAGTSLGTDPTAPHYKQAMKTMLELNKKELLCMTLFVIDDDCGGHEYIRTES* |
⦗Top⦘ |