NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102889_1081596

Scaffold Ga0102889_1081596


Overview

Basic Information
Taxon OID3300008964 Open in IMG/M
Scaffold IDGa0102889_1081596 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - metaG 1551A-02
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)966
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.187Long. (o)-123.8837Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F002060Metagenome / Metatranscriptome597Y

Sequences

Protein IDFamilyRBSSequence
Ga0102889_10815961F002060N/AMEINYISVVMAISAALVSGMGTALVAGFRDNKKEKVRRVERDQDLLKMDLKDLKIELYKIEKELNEWKDKYYNAIQELIGIKAELEATMIE
Ga0102889_10815962F000671AGGAMEKILCYCCNKSKNKLAVKKSSLLPINLFLCETCITAKFEPRWVIILSGRQLGPEAVKEFIVKKRYIGSDIAASELFV*
Ga0102889_10815963F000473AGGMEFINKDKDHFKYGINQWTGEPNKPVFYNKEMAIAVRGIKKPVINLQMDIIKYPEFLCLRLYKDNFIQYTGNNKEMVIDYLQKVKKLIESYGVRCELEGVPSQRVLGQGL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.