NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103732_1041628

Scaffold Ga0103732_1041628


Overview

Basic Information
Taxon OID3300008929 Open in IMG/M
Scaffold IDGa0103732_1041628 Open in IMG/M
Source Dataset NameEukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1A
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)695
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica → Eukaryotic And Microbial Communities From Ice Edge, Mcmurdo Sound, Antarctica

Source Dataset Sampling Location
Location NameIce edge, McMurdo Sound, Antarctica
CoordinatesLat. (o)-77.36Long. (o)164.28Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024804Metagenome / Metatranscriptome204Y

Sequences

Protein IDFamilyRBSSequence
Ga0103732_10416281F024804N/ALDIELDFFSRTFDDRRYKNARIVYDALLAKGEHPRVSIHTWELYDNAFSFARVRRYDLVQHHMDLLQHFEDNLNANFTNGQHLANFVQVAKAAQGAMNAKYHNGEFADPAAFDPTADHPVTWANVKL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.