Basic Information | |
---|---|
Taxon OID | 3300008884 Open in IMG/M |
Scaffold ID | Ga0103746_10055495 Open in IMG/M |
Source Dataset Name | Microbial communities of wastewater sludge from Singapore - Sludge3_b2_February |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 516 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Chelicerata → Arachnida → Acari → Acariformes → Trombidiformes → Prostigmata → Eupodina → Bdelloidea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge → Microbial Communities Of Wastewater Sludge From Singapore |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.2 | Long. (o) | 103.45 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015564 | Metagenome / Metatranscriptome | 253 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103746_100554951 | F015564 | N/A | VPTAGAHSVASSSHGSVTGDHGHGAPWEGVNLWRTPFKGDTDTVTQVKRTKGTLDRYVEARVRRIQELQLHALRNKATPTWVMMSRDRLLLAAQGILLCYVLYEAGAKVYNHLKAKDRLKLVKLLYKDNVD* |
⦗Top⦘ |