| Basic Information | |
|---|---|
| Taxon OID | 3300008781 Open in IMG/M |
| Scaffold ID | Ga0103596_10041 Open in IMG/M |
| Source Dataset Name | Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 100m_>1.6micron |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Institute of Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1410 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 18.9 | Long. (o) | -104.5 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010768 | Metagenome / Metatranscriptome | 299 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103596_100411 | F010768 | AGG | MKEVLNGGYNVHPVPPPNSETKERAARKYERKRSKTEKLFTLGYTTSGDPKKTGAK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |