Basic Information | |
---|---|
Taxon OID | 3300008781 Open in IMG/M |
Scaffold ID | Ga0103596_10041 Open in IMG/M |
Source Dataset Name | Microbial communities of ocean water from oxygen minimum zone off the coast of Manzanillo, Mexico - 100m_>1.6micron |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Georgia Institute of Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1410 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water → Microbial Communities Of Ocean Water From Oxygen Minimum Zone Off The Coast Of Manzanillo, Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pacific Ocean | |||||||
Coordinates | Lat. (o) | 18.9 | Long. (o) | -104.5 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010768 | Metagenome / Metatranscriptome | 299 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103596_100411 | F010768 | AGG | MKEVLNGGYNVHPVPPPNSETKERAARKYERKRSKTEKLFTLGYTTSGDPKKTGAK* |
⦗Top⦘ |