NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103649_100232

Scaffold Ga0103649_100232


Overview

Basic Information
Taxon OID3300008578 Open in IMG/M
Scaffold IDGa0103649_100232 Open in IMG/M
Source Dataset NameMicrobial communities of corn rhizosphere soil from Ohio, USA - Corn_Powermax_1a
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterAuburn University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)664
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa

Source Dataset Sampling Location
Location NameOhio, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001679Metagenome / Metatranscriptome653Y

Sequences

Protein IDFamilyRBSSequence
Ga0103649_1002322F001679N/AMWGMSRRQVAMKGVEGCDKPGGAVKRALIPGSLNYHGLNT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.