NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115336_119707

Scaffold Ga0115336_119707


Overview

Basic Information
Taxon OID3300008464 Open in IMG/M
Scaffold IDGa0115336_119707 Open in IMG/M
Source Dataset NameDeep sea sediment microbial communities from the Gulf of Mexico ? treatment with crude oil and Corexit
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Texas, Austin
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1814
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Sediment → Deep Sea Sediment Microbial Communities From The Gulf Of Mexico

Source Dataset Sampling Location
Location NameGulf of Mexico
CoordinatesLat. (o)27.0Long. (o)-88.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019802Metagenome / Metatranscriptome227Y

Sequences

Protein IDFamilyRBSSequence
Ga0115336_1197072F019802N/AMGVVDAAGFRGSRQSAFELMGLNLKLFDSMFGSQSTVAPPLPTAVDFIASLPEAAPIFTTTYSPLFPGIARLLDATEILAFLSSHHSLPIDMKPAIPRFIKNVVGRIGT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.