| Basic Information | |
|---|---|
| Taxon OID | 3300008450 Open in IMG/M |
| Scaffold ID | Ga0114880_1018227 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3305 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Viral Communities During Cyanobacterial Harmful Algal Blooms (Chabs) In Western Lake Erie, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Western Lake Erie | |||||||
| Coordinates | Lat. (o) | 41.7032 | Long. (o) | -83.2575 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013758 | Metagenome | 268 | Y |
| F059951 | Metagenome / Metatranscriptome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114880_10182271 | F059951 | N/A | MSLQDYAAIAVAIVTVLGGVAALLRFVILHYLAELKPNSGSSIKDQVNRLETRV |
| Ga0114880_10182276 | F013758 | AGG | MTAYTPDYKVIVNGTELSNITIADLTITSGRTDIYQQPVAGYCQLSLLNFDNATYDFNVGSGITVEVTDSVGAYIPIFGGSISDFTITVNSAGSLGYTTVATITALGALAKLPKIIDPGVLSQDQDGDQIYTLLSGYLLGSWNDVPAAQTWATYDPTETWANAVNIGLGDIDRPGSYDMISRSSSNTDLYSLTTAIANSAFGVLYEDANGNIGYADSTHRQDYLANNGYTTLDANHANGIGLSATTRAGDLRNSYTIVYDNNGNQTYTATDPISQATYGVYAEQFTSRIKNTVDAEALADRYIELRANPYPKFQSITFVLGNPEIDDADRDALINIFLGQPVWIQNLPPNITGGSFQGYIEGWTFRASLNNLTVTFNASPVSFSQVAVKWEQVNAAETWNTLNTSLTWLEAIGAVA* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |