Scaffold Ga0115359_10000052

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115359_10000052

Scaffold Ga0115359_10000052

Overview

Basic Information
Taxon OID	3300008340 Open in IMG/M
Scaffold ID	Ga0115359_10000052 Open in IMG/M
Source Dataset Name	Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC10B
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9624
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (92.31%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location Name	Gulf of Mexico
Coordinates	Lat. (^o)	27.4	Long. (^o)	-93.2	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071990	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115359_1000005210	F071990	AGGAGG	MAEPTTRFRLIPQNTAVADVNTPAKRLAAIAGESVVSTGIGNEADFGTIDISGGAANSSVLTILWDVTADGGNTLAETFKLWLSSNGFDQAGSVLKVRPLSGADQGGPSLTENYKANAGTGDYTFASMVEAEPGAINVWPSXEGTSMALSTDSDDVVFWAMYAAIAANETTGTYKGTDAGMELQFSFKYSYS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.