Basic Information | |
---|---|
Taxon OID | 3300008112 Open in IMG/M |
Scaffold ID | Ga0114345_1292860 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-100-LTR |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Michigan |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 545 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Erie, USA | |||||||
Coordinates | Lat. (o) | 41.8271 | Long. (o) | -83.1945 | Alt. (m) | Depth (m) | 8 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008744 | Metagenome / Metatranscriptome | 328 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0114345_12928601 | F008744 | N/A | LGVFEIDLQIKGKNFKHTVNVINQLTDNIIGIDFMHKHKLHYDVQTRQVKIAGVEIDQIVAIKEQTLPALASTVITAKYKGKVNKDMTYIASIFAPKTPTVSGMPAIVSIDKNNNCKIILDNCAPYDITIERNDVIGFMDIETDTLIPMEDATIAAILSDIDKHLPKVPKKKLTKEEIAA |
⦗Top⦘ |