NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114345_1018694

Scaffold Ga0114345_1018694


Overview

Basic Information
Taxon OID3300008112 Open in IMG/M
Scaffold IDGa0114345_1018694 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-100-LTR
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1831
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.8271Long. (o)-83.1945Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018161Metagenome / Metatranscriptome236N
F032250Metagenome / Metatranscriptome180N
F104441Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0114345_10186941F104441AGCAGMETSTNTDNPEKKQEIEKQKKLVADLFSTLNLVFTQTKLGVERSDLLFRAVHQFKTDILKIDPYWKLISWPHITIGRIFCSIDAIVIEDKWDCETNKFLFNEIKDAMM
Ga0114345_10186942F018161N/AMSELESKPDYSARQQVVRKIYKVLSRINCIPPFEDTINFRHLQRLHELMKELRLLNPEYPVTDVVQISELNILKNLDRIQTTRSWDDAGNKLVYINIQGEISKIRKFHPDWDVDLDCIYRYHICRCLRCKSEGFLCTQHVLDSSNEISSPQSDTSEEEKPFPALNSRQ*
Ga0114345_10186944F032250GGAMCTVEKEKSFLKMQNEGNSSQVDANREANTISTQVFKERDTYLQNILQIMEAVKEETVYQDNWLQYAVLHQNLMKLKEIDPNWKLVSYYEGDCIRLKHYSCSCF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.