NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104324_105066

Scaffold Ga0104324_105066


Overview

Basic Information
Taxon OID3300007820 Open in IMG/M
Scaffold IDGa0104324_105066 Open in IMG/M
Source Dataset NamePermafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterPrinceton University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1085
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Permafrost Core Soil Microbial Communities From Svalbard, Norway

Source Dataset Sampling Location
Location Namesvalbard,norway
CoordinatesLat. (o)78.11096Long. (o)15.55294Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F001079Metagenome / Metatranscriptome785Y
F001935Metagenome / Metatranscriptome615Y

Sequences

Protein IDFamilyRBSSequence
Ga0104324_1050662F001079N/AMAVIPAADWPLVFGSMQALKGHVQEYPGCQKLEAFVEPEGPDYRIHCYTVWDTPEQLEVFLERGYTFERMLADVAGIQAEAPRLMEKIF*
Ga0104324_1050663F000280GGAGMAEERSPARPLVGYRDVGGDVRHSRPQMVRSWIILVVLVLLYFGWTLTVYFLEPGLR*
Ga0104324_1050664F001935AGGCGGVYLKHLSSLQFLTYVSFFAVVLAALFKFVPGRSPPVREEPYPDEQLHAHDRKAAKYFLAGGFFLVLGALHMAVKNLPWLAEYLARTGYAGHLVRDLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.