| Basic Information | |
|---|---|
| Taxon OID | 3300007755 Open in IMG/M |
| Scaffold ID | Ga0105014_1057263 Open in IMG/M |
| Source Dataset Name | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate b |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Georgia Genomics Facility |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1223 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → environmental samples → uncultured delta proteobacterium HF0130_05G09 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cariaco Basin, Venezuela | |||||||
| Coordinates | Lat. (o) | 10.5 | Long. (o) | -64.66 | Alt. (m) | Depth (m) | 267 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092692 | Metagenome | 107 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105014_10572635 | F092692 | N/A | QMNFYEIKLNVVIDRNPPQALKHLRSALEEIFEKNRHLNKSKVNLVSIEDKKKR* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |