NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102856_1035732

Scaffold Ga0102856_1035732


Overview

Basic Information
Taxon OID3300007636 Open in IMG/M
Scaffold IDGa0102856_1035732 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - metaG 1371A-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)763
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2342Long. (o)-123.9167Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F025737Metagenome / Metatranscriptome200Y
F062746Metagenome / Metatranscriptome130Y
F063705Metagenome / Metatranscriptome129Y

Sequences

Protein IDFamilyRBSSequence
Ga0102856_10357321F025737GGAGMKPQDKDKLNECLSILDTTDLGLSLVWLWTWSTIKNFMADETFIMKKTEDEMWECLCEA
Ga0102856_10357322F000263AGGMNSEDIGLPPHLQRLVNAGVNGLDIMHGELKNLMLIAEEQLAWAQAIEDETEEAMDSMARTEAEGRLDALVELYKLTYDLSFAIGARNEATR*
Ga0102856_10357323F063705N/AMKLHLISLNQDWEAAKNNEPLRDDEYDPSDDYFLGAIEATEHLLSVATDIMNETNERV*
Ga0102856_10357324F062746N/AAKLFYLRTPSDLMDKEPLRKDLEDTVSFLQGLWAEGYFD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.