Basic Information | |
---|---|
Taxon OID | 3300007212 Open in IMG/M |
Scaffold ID | Ga0103958_1046778 Open in IMG/M |
Source Dataset Name | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Bottom layer) 7 sequencing projects |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | The Singapore Centre on Environmental Life Sciences Engineering |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4124 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.409238 | Long. (o) | 103.907928 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F045570 | Metagenome / Metatranscriptome | 152 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103958_10467787 | F045570 | GGAG | MATRRNFFKYLGLAGGVAGGGVVAAAAVLPDTEKAKCIKEIESAGFNGKLMIGAEYGELRPTEPNTFHFGPQFVPGTQKHVKASMTVGPDGEMYLYTNGKWRRIVTE* |
⦗Top⦘ |