NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102532_1121740

Scaffold Ga0102532_1121740


Overview

Basic Information
Taxon OID3300007094 Open in IMG/M
Scaffold IDGa0102532_1121740 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe Singapore Centre on Environmental Life Sciences Engineering
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1607
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Singapore - A Non-Axenic Oscillatoriales Culture (M13A)

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3991438Long. (o)103.77518Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001019Metagenome / Metatranscriptome804Y
F005745Metagenome / Metatranscriptome391Y
F083783Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0102532_11217403F001019GGAGGMSNYEPTLEILEIEYSFSPGGVDTYEVYDRDDSDPVSIPIFETESLTEAVQFCYDLGQDFTVRTLAAWHRHEEAEYEAV*
Ga0102532_11217406F005745AGGAGMHYDIENSEDLAPHLQRMVDHGVSGLDIMHGELKNLMLMADARFTEAQQIEEENDYSDAMESMERKYWEGMSDAYTHLYKLTYDLSFAIAGLRKDSNG*
Ga0102532_11217407F083783N/ARKMETEYINRKTQLVTYLQLHIQSLNEDLSQLSKTMDTLDPAEKEFEDLDIEYNFTSGQVSATMHILEYVEEIM*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.