| Basic Information | |
|---|---|
| Taxon OID | 3300006896 Open in IMG/M |
| Scaffold ID | Ga0102513_103516 Open in IMG/M |
| Source Dataset Name | Final time point T34 (3) (BES) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculum |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Shell Corporation |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2474 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.65 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030405 | Metagenome / Metatranscriptome | 185 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0102513_1035163 | F030405 | N/A | ACFCTRGAVQDYDGYYFILAMAKTVTPGGSPRREPGQAAPPTT* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |