| Basic Information | |
|---|---|
| Taxon OID | 3300006654 Open in IMG/M |
| Scaffold ID | Ga0101728_101859 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0125100, Gp0113270, Gp0125099 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6993 |
| Total Scaffold Genes | 17 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (64.71%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Abyssal Plane → Marine → Deep Marine Subsurface Microbial Communities From Mid-Atlantic Ridge (Iodp Expedition 336) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pond, Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 22.78 | Long. (o) | -46.09 | Alt. (m) | Depth (m) | 4350 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002030 | Metagenome | 601 | Y |
| F007771 | Metagenome / Metatranscriptome | 345 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101728_10185915 | F007771 | N/A | MKTIIHAKSIDKKVRLALYGMLHHSATKLFSRRMKYVSIKLHLKHYVYDGVAMIEEDTKITNPRNFKIIIDPYRLEKDDWGRERNYSEWVSELLRALAHEMVHVKQYIMGELTFKKGQMCWKKQKVDYKSGDDYYRSPHEVEANGLERWLQLGYTATWNKIEEKNG* |
| Ga0101728_1018592 | F002030 | AGGCGG | MIGLLIFGLVXLSTVFLWILIEERKSWKFLVWFIPVFLVLVTSTYVTYTSILGFPKVGIPEKGLYLRHYIDEPNWIYLWVLSKKNVPMSYQLVYSREKHNALEGVKGQAAEGAFMVLGEDESLGPGDGEGDQKGGRSGEGYTIGGDISFYKWDFTDNMPPKNTQE* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |