| Basic Information | |
|---|---|
| Taxon OID | 3300006517 Open in IMG/M |
| Scaffold ID | Ga0100964_100100 Open in IMG/M |
| Source Dataset Name | Sludge microbial communities from wastewater anaerobic digester in Oakland, CA, USA ? phosphite and CO2 enriched |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | QB3 Vincent J. Coates Genomics Sequencing Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1126 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → environmental samples → uncultured marine virus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Wastewater → Sludge Microbial Communities From Wastewater Anaerobic Digester In Oakland, Ca, Usa - Phosphite And Co2 Enriched |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Oakland, CA, USA | |||||||
| Coordinates | Lat. (o) | 37.825917 | Long. (o) | -122.295833 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011593 | Metagenome / Metatranscriptome | 289 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0100964_1001002 | F011593 | GAGG | MVTDNNLTAPPWCLGCPDPIYDDRRGEWDWYCRQHSPTGIRCSNVAVLRERCYRVREYFAKKEASK* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |