NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0100045_100558

Scaffold Ga0100045_100558


Overview

Basic Information
Taxon OID3300006450 Open in IMG/M
Scaffold IDGa0100045_100558 Open in IMG/M
Source Dataset NameMinimetagenome of a non-axenic cylindrospermopsis culture from a freshwater lake in Singapore
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8089
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (84.62%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Minimetagenome Of A Non-Axenic Cylindrospermopsis Culture From A Freshwater Lake In Singapore

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3991438Long. (o)103.77518Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051937Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0100045_1005585F051937AGGAGMLTAEQVGGIVRAIMAALGGYAVGQGLTDAETMATIGGAVTTLAAAIWSIWAKRKAATE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.