Basic Information | |
---|---|
Taxon OID | 3300006447 Open in IMG/M |
Scaffold ID | Ga0100194_104678 Open in IMG/M |
Source Dataset Name | Microbial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture A4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Agriculture and Agri-Food Canada |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2799 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Animal Waste → Unclassified → Unclassified → Manure → Microbial Communities From Manure Storage Tank From Sherbrooke, Qc, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sherbrooke, QC, Canada | |||||||
Coordinates | Lat. (o) | 45.4 | Long. (o) | -71.9 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F037272 | Metagenome / Metatranscriptome | 168 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0100194_1046782 | F037272 | GAGG | MTRKQIMRVHTAAGVEEIDADRLLVQEDEYVLFQGEEEVRRVPIADVLSETDPETGEETGGIETIYSRS* |
⦗Top⦘ |