| Basic Information | |
|---|---|
| Taxon OID | 3300006304 Open in IMG/M |
| Scaffold ID | Ga0068504_1077286 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_1000m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Hawaii |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1305 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → unclassified Nitrososphaerales → Nitrososphaerales archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine → Marine Microbial Communities From The North Pacific Subtropical Gyre, Aloha Station |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 22.75 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | 1000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024888 | Metagenome | 204 | Y |
| F042565 | Metagenome / Metatranscriptome | 158 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0068504_10772861 | F042565 | N/A | KRNGGEITVTDRTPEMDVKEFNRIESLVNKRVRWELGSEGYSIWSECGYKDIPTLAKAYRIS* |
| Ga0068504_10772862 | F024888 | AGGA | MKIDLKNIHKIVGEMVDAIHRKEMEGKTPDEFVQERGFSDWLEYAAWSRHTGGDYHMMEMMLKSKWKEQDPEEFARQKKIEGDQRTREHSYIGILDEEKIKKKNNGHKYYKPVHKSEFSAEELEVIYDERGVGGEPVEYRW* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |