Basic Information | |
---|---|
Taxon OID | 3300006092 Open in IMG/M |
Scaffold ID | Ga0082021_1164378 Open in IMG/M |
Source Dataset Name | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Nanyang Technological University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 22673 |
Total Scaffold Genes | 24 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (79.17%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant → Activated Sludge Microbial Communities From Wastewater Treatment Plant In Ulu Pandan, Singapore |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ulu Pandan, Singapore | |||||||
Coordinates | Lat. (o) | 1.3315 | Long. (o) | 103.7543 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006745 | Metagenome | 365 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0082021_11643783 | F006745 | GGGGG | VRVSDRGRRTSSAVALYVIVLVAFQVFLLTVAVEAFQTDQERLGWATAIVSVTLAAASAVLLRYLQP* |
⦗Top⦘ |