Basic Information | |
---|---|
Taxon OID | 3300006061 Open in IMG/M |
Scaffold ID | Ga0081201_105944 Open in IMG/M |
Source Dataset Name | Microbial communities from petroleum pipeline sediment, Khambat, Gujarat, India |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Anand Agricultural University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1320 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Industrial Production → Engineered Product → Unclassified → Unclassified → Petroleum Sediment → Microbial Communities From Petroleum Pipeline Sediment, Khambat, Gujarat, India |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Khambat, Gujarat, India | |||||||
Coordinates | Lat. (o) | 22.172778 | Long. (o) | 72.983333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068106 | Metagenome / Metatranscriptome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0081201_1059442 | F068106 | AGGAG | MPMMTTVIAVALGLAPIPADGTVPFVGADTEKMIGRYSETVDDTGTTHLRGVNRRTGQLYHITVNPYGRVEGSVGDWTVSFNVKTST* |
⦗Top⦘ |