NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075012_10312623

Scaffold Ga0075012_10312623


Overview

Basic Information
Taxon OID3300006033 Open in IMG/M
Scaffold IDGa0075012_10312623 Open in IMG/M
Source Dataset NameFreshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1066
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds → Freshwater And Sediment Microbial Communities From Various Areas In North America, Analyzing Microbe Dynamics In Response To Fracking

Source Dataset Sampling Location
Location NamePennsylvania, USA
CoordinatesLat. (o)40.0132Long. (o)-79.0717Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018913Metagenome / Metatranscriptome232Y
F032252Metagenome / Metatranscriptome180Y
F048267Metagenome / Metatranscriptome148Y
F090316Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0075012_103126232F048267N/AMTDKEWETALKNLNEGVKKWVNEEIDKIKYNVVKEIINRELKND*
Ga0075012_103126233F032252GAGGMTEMKLYRYKKDGHLYTLYEQLRPFYNLVAVPYFPNQGVLAKSKRSISMNDFIVVAER*
Ga0075012_103126235F018913AGCAGMTNQQRAEELLKVICKSEAHNTAWMLQEVLQQLRKQLSGTNKVDFTDELDVMFNAGWDECLKEIDAICDELELL*
Ga0075012_103126236F090316N/AMPDDLQREEELFFKALEEYKEKKSQEPTDKTTNTLPAVIAAVL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.