NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081455_10179799

Scaffold Ga0081455_10179799


Overview

Basic Information
Taxon OID3300005937 Open in IMG/M
Scaffold IDGa0081455_10179799 Open in IMG/M
Source Dataset NameTabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1603
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location
Location NameUniversity of Puerto Rico, San Juan, Puerto Rico
CoordinatesLat. (o)18.402889Long. (o)-66.050054Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041838Metagenome159Y

Sequences

Protein IDFamilyRBSSequence
Ga0081455_101797991F041838AGGALAMPRLQRRLVLTAGLAAAIGLSWYFWPRNDIPRLVTGPISVSYDPDATRLTAIVNVQNNSPRPVVASITNDVFIDSQKQPPNERGQSQPWRTELGSNQSNPVTFVLQGESAAAVWNGVRLMELTLNADYDEDAKLKCHFSFMGRFYPELKQIGIVSTATSPPECGGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.