NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0081455_10021243

Scaffold Ga0081455_10021243


Overview

Basic Information
Taxon OID3300005937 Open in IMG/M
Scaffold IDGa0081455_10021243 Open in IMG/M
Source Dataset NameTabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6092
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (64.29%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere → Tabebuia Heterophylla Rhizosphere Microbial Communities From The University Of Puerto Rico

Source Dataset Sampling Location
Location NameUniversity of Puerto Rico, San Juan, Puerto Rico
CoordinatesLat. (o)18.402889Long. (o)-66.050054Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006963Metagenome / Metatranscriptome361Y
F031679Metagenome / Metatranscriptome182Y
F043039Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0081455_1002124312F031679GGAGGMRAPIPTLEGLPAQAAIIIIGCLFVFLAALWLFVITKAMIAIGIGAVALFIAGACAFAHRYALKPL*
Ga0081455_100212436F043039GAGMLEIVELGRRGRQIKFTPERIEQIKNLVERGKSREEIAELIGVTLGSLQVTCSRLGISLRPPIINNGVRPRLKPVPTPPSKPAKAAEVARFTITMRYRGEERTTELPLTDNLIRQLAVEAAFRGVPIGYLIGDLIVGTLQAHAREEAAPAPSWATETEQRVAALGIAQELEGENDETAH*
Ga0081455_100212437F006963GGAMSRLLFATVLWALGIAQSLAQSAASQQLLELDDDERNAAFTLILKGSNRTCDQVVRTLFKGTAVGLDEWEVMCRNRNAYSLSVLTQGNETIINTLSCRELSATRKMLLRRAGITDRANGCRIK*
Ga0081455_100212439F031679GGAGGMRAPIPMPEGLPAQAAIIIIGCLFAFLVALWLFVITKTMIAIGIGAVALCIAGACAYAHRYALKPL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.