NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078893_10286232

Scaffold Ga0078893_10286232


Overview

Basic Information
Taxon OID3300005837 Open in IMG/M
Scaffold IDGa0078893_10286232 Open in IMG/M
Source Dataset NameExploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAustralian Centre for Ecogenomics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3629
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water → Exploring Phylogenetic Diversity In Port Hacking Ocean In Sydney, Australia

Source Dataset Sampling Location
Location NamePort Hacking, Australia
CoordinatesLat. (o)-34.1192Long. (o)151.2267Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004711Metagenome / Metatranscriptome427Y

Sequences

Protein IDFamilyRBSSequence
Ga0078893_102862323F004711AGGAGMARIGRKSTLEWIKKDYTSNPTRFCCEVIGMVSNLIASLILMWYSPNPPMFIAYIFFLVATCFLMYGAFSRKSFGFTAMYLVYLGIDGIGFLKTLS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.